Error

i have an .aspx file in .net 4 application cant access source code, generates following html\javascript lines of code: <script language="javascript"> function saveimage(){ app1.myname.connectionstring = 'fopwigdlgbksrgptiwpgskddgsgerqwwvdmsftapsdarqewfldszvkzlvkglkazxxcvlbmfkhpoiejkgjksdlfkldkajfakkglkdgpsggedtzxsadlklglpwriuqtjvnvkiweurqiwjfkdvbnbjeowqewptyiogxlmbxjgbortwoiqerpqiwioitowiyowiskblskogtiwotiwptqipvkvzlvkzalqpreppoypehlxbklsitpqrqprfkvzlvkpwroqproqpopazkvkzvzitwptipwtpwsop' app1.myname.connectionopen()= app1.myname.savetodb( ... </script> someone has decoded above connectionstring the: server=localhost;uid=xxxxxxxx;pwd=xxxxxxxxxx;database=xxxxxxxxxxxx;min pool size=5;maz pool size=100;connect timeout=15;;workstation id=1 i want know decoding , encoding algorithm may have been used here , tool can used encoding or decoding in above senario... thx

i building demo app using actionbar sherlock in android studio , facing problem , mentioned in following link :- previous problem now after following replies posted on above link did changes , facing gradle: execution failed task ':sherlocktest:processdebugmanifest'. > manifest merging failed. see console more info. my application manifest file :- <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="com.example.sherlocktest" android:versioncode="1" android:versionname="1.0" > <uses-sdk android:minsdkversion="10" android:targetsdkversion="16" /> <application android:allowbackup="true" android:icon="@drawable/ic_launcher" android:label="@string/app_name" android:theme="@style/apptheme" > ...

i new aptana, , have searched net see how handles gui development. i have tried following code. shows no bugs in console. however, not give me tk() window named mygui. from tkinter import * import ttk def main(): mygui = tk() mygui.title("my gui new") mygui.geometry('400x200+200+200') l = label(mygui, text="help") l.pack() if __name__ == "__main__": main() any pointers. able functions run in console, gui development not working out well. the-it right, want add mygui.mainloop() end of main . normally when i'm working in tkinter try move of information in function main if... clause. makes larger, more complex interfaces easier handle. a start use class: from tkinter import * ttk import * class app(frame): def __init__(self, master): frame.__init__(self, master) self.pack() self.create_widgets() def create_widgets(self): self.l = label(self, text=...

on satat command service want ser multiple pending intents broadcast on particular time in day use multiple alarm manager correct or wrong way please suggest me. @override public int onstartcommand(intent intent, int flags, int startid) { toast.maketext(this, "traffic control bk service started", toast.length_long).show(); log.d(tag, "onstart"); calendar calnow = calendar.getinstance(); calendar1 = calendar.getinstance(); date date1 = calendar1.gettime(); calendar2 = calendar.getinstance(); date date2 = calendar2.gettime(); calendar3 = calendar.getinstance(); date date3 = calendar3.gettime(); calendar4 = calendar.getinstance(); date date4 = calendar4.gettime(); calendar5 = calendar.getinstance(); date date5 = calendar5.gettime(); calendar6 = calendar.getinstance(); ...

when making: sudo git clone git@gitlab.mydomain.com:ws.git i error: > sudo git clone git@gitlab.mydomain.com:root/ws.git password: cloning 'ws'… authenticity of host 'gitlab.mydomain.com (x.x.x.x)' can't established. rsa key fingerprint xx:xx:xx…xx:xx. sure want continue connecting (yes/no)? yes warning: permanently added 'gitlab.mydomain.com,x.x.x.x' (rsa) list of known hosts. git@gitlab.mydomain.com's password: permission denied, please try again. git@gitlab.mydomain.com's password: fatal: 'root/ws.git' not appear git repository fatal: remote end hung unexpectedly even if change url: > sudo git clone git@gitlab.mydomain.com:ws.git password: cloning 'ws'… git@gitlab.mydomain.com's password: fatal: 'ws.git' not appear git repository fatal: remote end hung unexpectedly what problem? is problem public cloning? can clone adding personal ssh key? update: added personal ssh-key: now: ssh -tvvv...

i using regular expression find sequences of numbers aren't refixed 0x . eg. 0 50505 20201 0012 my regular expression (?:[^(0x)]\d+) , (in head) translates match sequence of digits not started 0x . doesn't work - assumption incorrectly making? [^(0x)] in regular expression match character not ( , 0 , x , ) . use negative lookbehind: >>> re.findall(r'(?<!0x)\d+\b', '0 0x111 50505 20201 0012') ['0', '11', '50505', '20201', '0012'] from http://docs.python.org/2/library/re.html (?<!...) matches if current position in string not preceded match .... called negative lookbehind assertion. similar positive lookbehind assertions, contained pattern must match strings of fixed length. patterns start negative lookbehind assertions may match @ beginning of string being searched. update use following regular expression: >>> re.findall(r'\b\d+\b', ...

in code outer sqlite query first finish work goes inner sqlite query please explain me why happen , give solution of requirment. /*outer sqlite query*/ db.transaction(function(transaction){ transaction.executesql('select * outertable;', [], function(transaction,results){ if (results != null && results.rows != null) { (var = 0; < results.rows.length; i++) { /*my work going here*/ /*inner sqlite query inside lor loop*/ db.transaction(function(transaction){ transaction.executesql('select * myinnertable;',[], function(transaction, result){ if (result != null && result.rows != null) { (var j = 0; j < result.rows.length; j++) { /* work going here */ } } },errorhandler); } ,errorhandler,nullhandler); /*inner sqlite end here*/ } ...